PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008223716.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 321aa    MW: 36448 Da    PI: 6.2881
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008223716.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM135.82.9e-42421672128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     ppG+rF+P d elv  yL+kk+++++l+  + i++v++yk++P +L + +++ +e+e+yfF++rdkky++g r+nra+ +gyWkatg +k+v+  
  XP_008223716.1  42 PPGYRFKPLDGELVAIYLRKKIANEPLPP-NKIHDVELYKFNPDTLSEIYESyGEDEMYFFTSRDKKYPNGARPNRAAGDGYWKATGVKKKVKF- 134
                     9*************************999.77**************8544443778*************************************9. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++ +vg k++Lvfy+g+ p+g ktdW mhe+++
  XP_008223716.1 135 EDVEVGSKTSLVFYRGKPPHGDKTDWKMHEFQV 167
                     9999***************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-4837192IPR003441NAC domain
PROSITE profilePS5100546.27941192IPR003441NAC domain
PfamPF023651.0E-2042166IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MEKQSISSKA SIVTKNGSDL HGGHTGSYDS YYDDASYFDS IPPGYRFKPL DGELVAIYLR  60
KKIANEPLPP NKIHDVELYK FNPDTLSEIY ESYGEDEMYF FTSRDKKYPN GARPNRAAGD  120
GYWKATGVKK KVKFEDVEVG SKTSLVFYRG KPPHGDKTDW KMHEFQVNAP PKRKDRNNMR  180
LDDCVLSRIY NKHNHSKDSN QSNNNGVEIQ EQPNVGSNSQ DNAHVSGEVV DHPPANSHEL  240
TSLLSNQNCY YNTDQSEILN STNCMGFDGP FGVVSISSTL SFQNPQQFNG YQKGQRFCDL  300
PSEFYTNYDQ WLNDTAKDLT H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-45341948170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008223716.10.0PREDICTED: NAC transcription factor 29-like
SwissprotO492555e-50NAC29_ARATH; NAC transcription factor 29
SwissprotA0SPJ97e-49NAM2_HORVD; NAC transcription factor NAM-2
TrEMBLM5XRH11e-149M5XRH1_PRUPE; Uncharacterized protein
STRINGPOPTR_0018s10310.13e-57(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101121642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.12e-49NAC-like, activated by AP3/PI